SCOPe 2.08: Domain d7d8nb1: 7d8n B:2-114

Lineage for d7d8nb1 (7d8n B:2-114)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188940] (31 PDB entries)

8. Domain d7d8nb1: 7d8n B:2-114 [405216]
   Other proteins in same PDB: d7d8na2, d7d8na3, d7d8nb2, d7d8nb3
   automated match to d2dexx2
   complexed with ca, cl, gol

Details for d7d8nb1

PDB Entry: 7d8n, 2.75 Å

PDB Description: structure of the inactive form of wild-type peptidylarginine deiminase type iii (pad3) crystallized under the condition with high concentrations of ca2+

PDB Compounds: (B:) Protein-arginine deiminase type-3

SCOPe Domain Sequences for d7d8nb1:

Sequence, based on SEQRES records:

>d7d8nb1 b.6.1.0 (B:2-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slqrivrvslehptsavcvagvetlvdiygsvpegtemfevygtpgvdiyispnmergre
radtrrwrfdatleiivvmnspsndlndshvqisyhssheplplayavlyltc

Sequence, based on observed residues (ATOM records):

>d7d8nb1 b.6.1.0 (B:2-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slqrivrvslehptsavcvagvetlvdiygsvpegtemfevygtpgvdiyisdtrrwrfd
atleiivvmnspsndlndshvqisyhssheplplayavlyltc

Timeline for d7d8nb1:

• d7d8nb1 first appeared in SCOPe 2.07