Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Ubiquitin [54238] (9 species) |
Species Human (Homo sapiens) [TaxId:9606] [54239] (307 PDB entries) Uniprot P62988 identical sequence in many other species |
Domain d7e8il_: 7e8i L: [405215] Other proteins in same PDB: d7e8ib_, d7e8ic_, d7e8id_, d7e8if_, d7e8ig_, d7e8ih_ automated match to d3rula_ protein/DNA complex |
PDB Entry: 7e8i (more details), 3.1 Å
SCOPe Domain Sequences for d7e8il_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7e8il_ d.15.1.1 (L:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgc
Timeline for d7e8il_: