Lineage for d1a81k1 (1a81 K:9-117)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135973Fold d.93: SH2-like [55549] (1 superfamily)
  4. 135974Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 135975Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 136101Protein Syk tyrosine kinase [55575] (1 species)
  7. 136102Species Human (Homo sapiens) [TaxId:9606] [55576] (3 PDB entries)
  8. 136113Domain d1a81k1: 1a81 K:9-117 [40517]

Details for d1a81k1

PDB Entry: 1a81 (more details), 3 Å

PDB Description: crystal structure of the tandem sh2 domain of the syk kinase bound to a dually tyrosine-phosphorylated itam

SCOP Domain Sequences for d1a81k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a81k1 d.93.1.1 (K:9-117) Syk tyrosine kinase {Human (Homo sapiens)}
sanhlpfffgnitreeaedylvqggmsdglyllrqsrnylggfalsvahgrkahhytier
elngtyaiaggrthaspadlchyhsqesdglvcllkkpfnrpqgvqpkt

SCOP Domain Coordinates for d1a81k1:

Click to download the PDB-style file with coordinates for d1a81k1.
(The format of our PDB-style files is described here.)

Timeline for d1a81k1: