![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
![]() | Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) ![]() duplication: contains two structural repeats |
![]() | Family f.43.1.0: automated matches [276197] (1 protein) not a true family |
![]() | Protein automated matches [276200] (4 species) not a true protein |
![]() | Species Chlamydomonas reinhardtii [TaxId:3055] [370435] (5 PDB entries) |
![]() | Domain d7dz81_: 7dz8 1: [405167] Other proteins in same PDB: d7dz8b_, d7dz8c_, d7dz8d_, d7dz8e_, d7dz8f_, d7dz8j_, d7dz8u_, d7dz8w_, d7dz8x_, d7dz8y_, d7dz8z_ automated match to d4y281_ complexed with bcr, chl, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, tpo, xat; mutant |
PDB Entry: 7dz8 (more details), 3.16 Å
SCOPe Domain Sequences for d7dz81_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dz81_ f.43.1.0 (1:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]} kagnwlpgsdapawlpddlpgnygfdplslgkepaslkrftesevihgrwamlgvagsla vellgygnwydaplwavnggkatwfgievpfdlnallafefvamaaaegqrgdaggvvyp ggafdplgfakdssksgelklkeikngrlamvaflgfvaqhaatgkgpiaalgehlanpw ganfatngisvpff
Timeline for d7dz81_: