| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
| Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
| Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55991] (10 PDB entries) Uniprot P12004 |
| Domain d7efaa1: 7efa A:1-126 [405163] automated match to d1u7ba1 protein/DNA complex |
PDB Entry: 7efa (more details), 2.7 Å
SCOPe Domain Sequences for d7efaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7efaa1 d.131.1.2 (A:1-126) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql
Timeline for d7efaa1: