![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
![]() | Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) ![]() duplication: contains two structural repeats |
![]() | Family f.43.1.1: Chlorophyll a-b binding protein [103512] (2 proteins) |
![]() | Protein automated matches [190507] (3 species) not a true protein |
![]() | Species Chlamydomonas reinhardtii [TaxId:3055] [377998] (5 PDB entries) |
![]() | Domain d7dz8x_: 7dz8 X: [405138] Other proteins in same PDB: d7dz81_, d7dz83_, d7dz84_, d7dz87_, d7dz88_, d7dz89_, d7dz8a_, d7dz8b_, d7dz8c_, d7dz8d_, d7dz8e_, d7dz8f_, d7dz8j_, d7dz8v_ automated match to d5xnl2_ complexed with bcr, chl, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, tpo, xat; mutant |
PDB Entry: 7dz8 (more details), 3.16 Å
SCOPe Domain Sequences for d7dz8x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dz8x_ f.43.1.1 (X:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]} aiewygpdrpkflgpfsegdtpayltgefpgdygwdtaglsadpetfkryreleliharw amlgalgcitpellakngipfgeavwfkagaqifaegglnylgnenlihaqsiiatlafq vvvmglaeayranggplgegldplhpggafdplgladdpdtfaelkvkeikngrlamfsm fgffvqaivtgkgpiqnlddhlanptavnafayatkftpsa
Timeline for d7dz8x_: