Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) duplication: contains two structural repeats |
Family f.43.1.1: Chlorophyll a-b binding protein [103512] (2 proteins) |
Protein automated matches [190507] (3 species) not a true protein |
Species Chlamydomonas reinhardtii [TaxId:3055] [377998] (5 PDB entries) |
Domain d7e0jx_: 7e0j X: [405118] automated match to d5xnl2_ complexed with chl, cla, lhg, lut, nex, tpo, xat; mutant |
PDB Entry: 7e0j (more details), 3.13 Å
SCOPe Domain Sequences for d7e0jx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7e0jx_ f.43.1.1 (X:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]} iewygpdrpkflgpfsegdtpayltgefpgdygwdtaglsadpetfkryreleliharwa mlgalgcitpellakngipfgeavwfkagaqifaegglnylgnenlihaqsiiatlafqv vvmglaeayranggplgegldplhpggafdplgladdpdtfaelkvkeikngrlamfsmf gffvqaivtgkgpiqnlddhlanptavnafayatkftpsa
Timeline for d7e0jx_: