SCOPe 2.08: Domain d7ddqg_: 7ddq g:

Lineage for d7ddqg_ (7ddq g:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
   membrane all-alpha fold

4. Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families)

5. Family f.3.1.0: automated matches [254203] (1 protein)
   not a true family

6. Protein automated matches [254444] (10 species)
   not a true protein

7. Species Rhodobacter veldkampii [TaxId:1185920] [404997] (1 PDB entry)

8. Domain d7ddqg_: 7ddq g: [405090]
   Other proteins in same PDB: d7ddqb_, d7ddqe_, d7ddqf_, d7ddqh1, d7ddqh2, d7ddqi_, d7ddqj_, d7ddqk_, d7ddql_, d7ddqm_, d7ddqr_
   automated match to d1xrda1
   complexed with 3pe, bcl, bph, fe, spo, u10

Details for d7ddqg_

PDB Entry: 7ddq, 2.84 Å

PDB Description: structure of rc-lh1-pufx from rhodobacter veldkampii

PDB Compounds: (g:) Antenna pigment protein alpha chain

SCOPe Domain Sequences for d7ddqg_:

Sequence; same for both SEQRES and ATOM records:

>d7ddqg_ f.3.1.0 (g:) automated matches {Rhodobacter veldkampii [TaxId: 1185920]}
skfykiwlifdprrvfvaqgvflfllavmihlmllsnpgfnwldisgvkyerv

Timeline for d7ddqg_:

• d7ddqg_ first appeared in SCOPe 2.07