Lineage for d1a81c1 (1a81 C:9-137)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34525Fold d.93: SH2-like [55549] (1 superfamily)
  4. 34526Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 34527Family d.93.1.1: SH2 domain [55551] (19 proteins)
  6. 34645Protein Syk tyrosine kinase [55575] (1 species)
  7. 34646Species Human (Homo sapiens) [TaxId:9606] [55576] (3 PDB entries)
  8. 34649Domain d1a81c1: 1a81 C:9-137 [40509]

Details for d1a81c1

PDB Entry: 1a81 (more details), 3 Å

PDB Description: crystal structure of the tandem sh2 domain of the syk kinase bound to a dually tyrosine-phosphorylated itam

SCOP Domain Sequences for d1a81c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a81c1 d.93.1.1 (C:9-137) Syk tyrosine kinase {Human (Homo sapiens)}
sanhlpfffgnitreeaedylvqggmsdglyllrqsrnylggfalsvahgrkahhytier
elngtyaiaggrthaspadlchyhsqesdglvcllkkpfnrpqgvqpktgpfedlkenli
reyvkqtwn

SCOP Domain Coordinates for d1a81c1:

Click to download the PDB-style file with coordinates for d1a81c1.
(The format of our PDB-style files is described here.)

Timeline for d1a81c1: