SCOPe 2.08: Domain d7ddqh2: 7ddq H:36-250

Lineage for d7ddqh2 (7ddq H:36-250)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.0: automated matches [227212] (1 protein)
   not a true family

6. Protein automated matches [226947] (5 species)
   not a true protein

7. Species Rhodobacter veldkampii [TaxId:1185920] [405084] (1 PDB entry)

8. Domain d7ddqh2: 7ddq H:36-250 [405085]
   Other proteins in same PDB: d7ddqa_, d7ddqb_, d7ddqd_, d7ddqe_, d7ddqf_, d7ddqg_, d7ddqh1, d7ddqi_, d7ddqj_, d7ddqk_, d7ddql_, d7ddqm_, d7ddqn_, d7ddqo_, d7ddqr_, d7ddqs_, d7ddqt_, d7ddqu_
   automated match to d1l9bh1
   complexed with 3pe, bcl, bph, fe, spo, u10

Details for d7ddqh2

PDB Entry: 7ddq, 2.84 Å

PDB Description: structure of rc-lh1-pufx from rhodobacter veldkampii

PDB Compounds: (H:) Photosynthetic reaction center subunit H

SCOPe Domain Sequences for d7ddqh2:

Sequence; same for both SEQRES and ATOM records:

>d7ddqh2 b.41.1.0 (H:36-250) automated matches {Rhodobacter veldkampii [TaxId: 1185920]}
mregyplenedggpavnqgpfplpsqktfklphgrgevtvpdykkeardvalartavndg
fphaptgnpmldgvgpaswaprrdipeldghghakvvpmsvasaffvsagrdprglpvia
ndmktvgtvtemwvdvaehmvrylevdlasggkclvpmtmaiikkhavvvqsissaafas
vpqtksmteismleeekicayfaggtmycadakpk

Timeline for d7ddqh2:

• d7ddqh2 first appeared in SCOPe 2.07