SCOPe 2.08: Domain d7ddqh1: 7ddq H:1-35

Lineage for d7ddqh1 (7ddq H:1-35)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families)

5. Family f.23.10.0: automated matches [227192] (1 protein)
   not a true family

6. Protein automated matches [226917] (6 species)
   not a true protein

7. Species Rhodobacter veldkampii [TaxId:1185920] [405082] (1 PDB entry)

8. Domain d7ddqh1: 7ddq H:1-35 [405083]
   Other proteins in same PDB: d7ddqa_, d7ddqb_, d7ddqd_, d7ddqe_, d7ddqf_, d7ddqg_, d7ddqh2, d7ddqi_, d7ddqj_, d7ddqk_, d7ddql_, d7ddqm_, d7ddqn_, d7ddqo_, d7ddqr_, d7ddqs_, d7ddqt_, d7ddqu_
   automated match to d2hh1h1
   complexed with 3pe, bcl, bph, fe, spo, u10

Details for d7ddqh1

PDB Entry: 7ddq, 2.84 Å

PDB Description: structure of rc-lh1-pufx from rhodobacter veldkampii

PDB Compounds: (H:) Photosynthetic reaction center subunit H

SCOPe Domain Sequences for d7ddqh1:

Sequence; same for both SEQRES and ATOM records:

>d7ddqh1 f.23.10.0 (H:1-35) automated matches {Rhodobacter veldkampii [TaxId: 1185920]}
mvgvnffgdfdlaslaiwsfwlffallvyylqten

Timeline for d7ddqh1:

• d7ddqh1 first appeared in SCOPe 2.07