SCOPe 2.08: Domain d7ddqe_: 7ddq E:

Lineage for d7ddqe_ (7ddq E:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
   membrane all-alpha fold

4. Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families)

5. Family f.3.1.1: Light-harvesting complex subunits [56919] (2 proteins)

6. Protein automated matches [404989] (4 species)
   not a true protein

7. Species Rhodobacter veldkampii [TaxId:1185920] [404990] (1 PDB entry)

8. Domain d7ddqe_: 7ddq E: [405073]
   Other proteins in same PDB: d7ddqa_, d7ddqd_, d7ddqg_, d7ddqh1, d7ddqh2, d7ddql_, d7ddqm_, d7ddqn_, d7ddqo_, d7ddqs_, d7ddqt_, d7ddqu_
   automated match to d1jo5a_
   complexed with 3pe, bcl, bph, fe, spo, u10

Details for d7ddqe_

PDB Entry: 7ddq, 2.84 Å

PDB Description: structure of rc-lh1-pufx from rhodobacter veldkampii

PDB Compounds: (E:) Antenna pigment protein beta chain

SCOPe Domain Sequences for d7ddqe_:

Sequence; same for both SEQRES and ATOM records:

>d7ddqe_ f.3.1.1 (E:) automated matches {Rhodobacter veldkampii [TaxId: 1185920]}
dlsftgltdqqaqelhsvylqgmwlfisvaivahlavfiwrpwl

Timeline for d7ddqe_:

• d7ddqe_ first appeared in SCOPe 2.07