Lineage for d7ddqe_ (7ddq E:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021592Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
    membrane all-alpha fold
  4. 3021593Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) (S)
  5. 3021594Family f.3.1.1: Light-harvesting complex subunits [56919] (2 proteins)
  6. 3021647Protein automated matches [404989] (4 species)
    not a true protein
  7. 3021648Species Rhodobacter veldkampii [TaxId:1185920] [404990] (1 PDB entry)
  8. 3021650Domain d7ddqe_: 7ddq E: [405073]
    Other proteins in same PDB: d7ddqa_, d7ddqd_, d7ddqg_, d7ddqh1, d7ddqh2, d7ddql_, d7ddqm_, d7ddqn_, d7ddqo_, d7ddqs_, d7ddqt_, d7ddqu_
    automated match to d1jo5a_
    complexed with 3pe, bcl, bph, fe, spo, u10

Details for d7ddqe_

PDB Entry: 7ddq (more details), 2.84 Å

PDB Description: structure of rc-lh1-pufx from rhodobacter veldkampii
PDB Compounds: (E:) Antenna pigment protein beta chain

SCOPe Domain Sequences for d7ddqe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ddqe_ f.3.1.1 (E:) automated matches {Rhodobacter veldkampii [TaxId: 1185920]}
dlsftgltdqqaqelhsvylqgmwlfisvaivahlavfiwrpwl

SCOPe Domain Coordinates for d7ddqe_:

Click to download the PDB-style file with coordinates for d7ddqe_.
(The format of our PDB-style files is described here.)

Timeline for d7ddqe_: