Lineage for d7d56c1 (7d56 C:1-114)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381958Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2381959Protein automated matches [190824] (29 species)
    not a true protein
  7. 2382186Species Human (Homo sapiens) [TaxId:9606] [188940] (31 PDB entries)
  8. 2382240Domain d7d56c1: 7d56 C:1-114 [405070]
    Other proteins in same PDB: d7d56a2, d7d56a3, d7d56b2, d7d56b3, d7d56c2, d7d56c3
    automated match to d2dexx2
    complexed with bfb, ca, cl, edo, gol

Details for d7d56c1

PDB Entry: 7d56 (more details), 3.18 Å

PDB Description: structure of the peptidylarginine deiminase type iii (pad3) in complex with cl-amidine
PDB Compounds: (C:) Protein-arginine deiminase type-3

SCOPe Domain Sequences for d7d56c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7d56c1 b.6.1.0 (C:1-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mslqrivrvslehptsavcvagvetlvdiygsvpegtemfevygtpgvdiyispnmergr
eradtrrwrfdatleiivvmnspsndlndshvqisyhssheplplayavlyltc

SCOPe Domain Coordinates for d7d56c1:

Click to download the PDB-style file with coordinates for d7d56c1.
(The format of our PDB-style files is described here.)

Timeline for d7d56c1: