Lineage for d7dz8j_ (7dz8 J:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631539Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) (S)
    automatically mapped to Pfam PF01701
  5. 2631562Family f.23.18.0: automated matches [276196] (1 protein)
    not a true family
  6. 2631563Protein automated matches [276198] (4 species)
    not a true protein
  7. 2631566Species Chlamydomonas reinhardtii [TaxId:3055] [370433] (4 PDB entries)
  8. 2631568Domain d7dz8j_: 7dz8 J: [405064]
    Other proteins in same PDB: d7dz81_, d7dz83_, d7dz84_, d7dz87_, d7dz88_, d7dz89_, d7dz8a_, d7dz8b_, d7dz8c_, d7dz8d_, d7dz8e_, d7dz8f_, d7dz8u_, d7dz8v_, d7dz8w_, d7dz8x_, d7dz8y_, d7dz8z_
    automated match to d5l8rj_
    complexed with bcr, chl, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, tpo, xat; mutant

Details for d7dz8j_

PDB Entry: 7dz8 (more details), 3.16 Å

PDB Description: state transition supercomplex psi-lhci-lhcii from the lhcbm1 lacking mutant of chlamydomonas reinhardtii
PDB Compounds: (J:) Photosystem I reaction center subunit IX

SCOPe Domain Sequences for d7dz8j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dz8j_ f.23.18.0 (J:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
mkdfttylstapviatiwftftagllieinryfpdplvfsf

SCOPe Domain Coordinates for d7dz8j_:

Click to download the PDB-style file with coordinates for d7dz8j_.
(The format of our PDB-style files is described here.)

Timeline for d7dz8j_: