SCOPe 2.08: Domain d7ddqt_: 7ddq t:

Lineage for d7ddqt_ (7ddq t:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
   membrane all-alpha fold

4. Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families)

5. Family f.3.1.0: automated matches [254203] (1 protein)
   not a true family

6. Protein automated matches [254444] (10 species)
   not a true protein

7. Species Rhodobacter veldkampii [TaxId:1185920] [404997] (1 PDB entry)

8. Domain d7ddqt_: 7ddq t: [405059]
   Other proteins in same PDB: d7ddqb_, d7ddqe_, d7ddqf_, d7ddqh1, d7ddqh2, d7ddqi_, d7ddqj_, d7ddqk_, d7ddql_, d7ddqm_, d7ddqr_
   automated match to d1xrda1
   complexed with 3pe, bcl, bph, fe, spo, u10

Details for d7ddqt_

PDB Entry: 7ddq, 2.84 Å

PDB Description: structure of rc-lh1-pufx from rhodobacter veldkampii

PDB Compounds: (t:) Antenna pigment protein alpha chain

SCOPe Domain Sequences for d7ddqt_:

Sequence; same for both SEQRES and ATOM records:

>d7ddqt_ f.3.1.0 (t:) automated matches {Rhodobacter veldkampii [TaxId: 1185920]}
skfykiwlifdprrvfvaqgvflfllavmihlmllsnpgfnwldisgvkyerv

Timeline for d7ddqt_:

• d7ddqt_ first appeared in SCOPe 2.07