Lineage for d7dl8c_ (7dl8 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957073Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2957430Superfamily d.68.6: AlbA-like [82704] (3 families) (S)
  5. 2957478Family d.68.6.0: automated matches [191549] (1 protein)
    not a true family
  6. 2957479Protein automated matches [190948] (3 species)
    not a true protein
  7. 2957489Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [405032] (1 PDB entry)
  8. 2957490Domain d7dl8c_: 7dl8 C: [405033]
    automated match to d1vm0a_

Details for d7dl8c_

PDB Entry: 7dl8 (more details), 2.46 Å

PDB Description: crystal structure of alba1 from trypanosoma brucei
PDB Compounds: (C:) ALBA-Domain Protein

SCOPe Domain Sequences for d7dl8c_:

Sequence, based on SEQRES records: (download)

>d7dl8c_ d.68.6.0 (C:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
prnsvrvgyrgtkflfvditkhllhdgekevyvsalggaineavsvvemlkdqqmvvvkk
ittsrqvseepddgpvdkieivvtkadgfdakyeeqqkareakr

Sequence, based on observed residues (ATOM records): (download)

>d7dl8c_ d.68.6.0 (C:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
prnsvrvgyrgtkflfvditkhllhdgekevyvsalggaineavsvvemlkdqqmvvvkk
ittsrqvgpvdkieivvtkadgfdakyeeqqkareakr

SCOPe Domain Coordinates for d7dl8c_:

Click to download the PDB-style file with coordinates for d7dl8c_.
(The format of our PDB-style files is described here.)

Timeline for d7dl8c_: