Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
Superfamily d.68.6: AlbA-like [82704] (3 families) |
Family d.68.6.0: automated matches [191549] (1 protein) not a true family |
Protein automated matches [190948] (3 species) not a true protein |
Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [405032] (1 PDB entry) |
Domain d7dl8c_: 7dl8 C: [405033] automated match to d1vm0a_ |
PDB Entry: 7dl8 (more details), 2.46 Å
SCOPe Domain Sequences for d7dl8c_:
Sequence, based on SEQRES records: (download)
>d7dl8c_ d.68.6.0 (C:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} prnsvrvgyrgtkflfvditkhllhdgekevyvsalggaineavsvvemlkdqqmvvvkk ittsrqvseepddgpvdkieivvtkadgfdakyeeqqkareakr
>d7dl8c_ d.68.6.0 (C:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} prnsvrvgyrgtkflfvditkhllhdgekevyvsalggaineavsvvemlkdqqmvvvkk ittsrqvgpvdkieivvtkadgfdakyeeqqkareakr
Timeline for d7dl8c_: