![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily) membrane all-alpha fold |
![]() | Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) ![]() |
![]() | Family f.3.1.0: automated matches [254203] (1 protein) not a true family |
![]() | Protein automated matches [254444] (10 species) not a true protein |
![]() | Species Rhodobacter veldkampii [TaxId:1185920] [404997] (1 PDB entry) |
![]() | Domain d7ddqn_: 7ddq n: [405019] Other proteins in same PDB: d7ddqb_, d7ddqe_, d7ddqf_, d7ddqh1, d7ddqh2, d7ddqi_, d7ddqj_, d7ddqk_, d7ddql_, d7ddqm_, d7ddqr_ automated match to d1xrda1 complexed with 3pe, bcl, bph, fe, spo, u10 |
PDB Entry: 7ddq (more details), 2.84 Å
SCOPe Domain Sequences for d7ddqn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ddqn_ f.3.1.0 (n:) automated matches {Rhodobacter veldkampii [TaxId: 1185920]} skfykiwlifdprrvfvaqgvflfllavmihlmllsnpgfnwldisgvkyerv
Timeline for d7ddqn_: