Lineage for d7ddqn_ (7ddq n:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021592Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
    membrane all-alpha fold
  4. 3021593Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) (S)
  5. 3021656Family f.3.1.0: automated matches [254203] (1 protein)
    not a true family
  6. 3021657Protein automated matches [254444] (10 species)
    not a true protein
  7. 3021692Species Rhodobacter veldkampii [TaxId:1185920] [404997] (1 PDB entry)
  8. 3021696Domain d7ddqn_: 7ddq n: [405019]
    Other proteins in same PDB: d7ddqb_, d7ddqe_, d7ddqf_, d7ddqh1, d7ddqh2, d7ddqi_, d7ddqj_, d7ddqk_, d7ddql_, d7ddqm_, d7ddqr_
    automated match to d1xrda1
    complexed with 3pe, bcl, bph, fe, spo, u10

Details for d7ddqn_

PDB Entry: 7ddq (more details), 2.84 Å

PDB Description: structure of rc-lh1-pufx from rhodobacter veldkampii
PDB Compounds: (n:) Antenna pigment protein alpha chain

SCOPe Domain Sequences for d7ddqn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ddqn_ f.3.1.0 (n:) automated matches {Rhodobacter veldkampii [TaxId: 1185920]}
skfykiwlifdprrvfvaqgvflfllavmihlmllsnpgfnwldisgvkyerv

SCOPe Domain Coordinates for d7ddqn_:

Click to download the PDB-style file with coordinates for d7ddqn_.
(The format of our PDB-style files is described here.)

Timeline for d7ddqn_: