Lineage for d7dh8a_ (7dh8 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2308589Species Xanthomonas campestris [TaxId:314565] [404953] (2 PDB entries)
  8. 2308590Domain d7dh8a_: 7dh8 A: [405009]
    automated match to d4mtec_
    complexed with zn

Details for d7dh8a_

PDB Entry: 7dh8 (more details), 1.85 Å

PDB Description: crystal structure of holo xczur
PDB Compounds: (A:) Transcriptional regulator fur family

SCOPe Domain Sequences for d7dh8a_:

Sequence, based on SEQRES records: (download)

>d7dh8a_ a.4.5.0 (A:) automated matches {Xanthomonas campestris [TaxId: 314565]}
ansfvraveracserglrltpiranvlrliadagkpvkayelldwvregkgvgadapptv
yraldflmangfvhklesvnafvachhpnsaqhsvpflicdrchsaveledrdvvsqlea
rakalgfqpqaqtlevhglcakcaaa

Sequence, based on observed residues (ATOM records): (download)

>d7dh8a_ a.4.5.0 (A:) automated matches {Xanthomonas campestris [TaxId: 314565]}
ansfvraveracserglrltpiranvlrliadagkpvkayelldwvreadapptvyrald
flmangfvhklesvnafvachhpnsaqhsvpflicdrchsaveledrdvvsqlearakal
gfqpqaqtlevhglcakcaaa

SCOPe Domain Coordinates for d7dh8a_:

Click to download the PDB-style file with coordinates for d7dh8a_.
(The format of our PDB-style files is described here.)

Timeline for d7dh8a_: