SCOPe 2.08: Domain d7dfue_: 7dfu E:

Lineage for d7dfue_ (7dfu E:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (71 species)
   not a true protein

7. Species Xanthomonas oryzae [TaxId:347] [404965] (2 PDB entries)

8. Domain d7dfue_: 7dfu E: [405001]
   automated match to d1tg6f_
   complexed with cl, eza, mg

Details for d7dfue_

PDB Entry: 7dfu, 1.9 Å

PDB Description: crystal structure of xanthomonas oryzae clpp s68y in complex with adep4.

PDB Compounds: (E:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d7dfue_:

Sequence, based on SEQRES records:

>d7dfue_ c.14.1.0 (E:) automated matches {Xanthomonas oryzae [TaxId: 347]}
tsrgeraydiysrllkerliflvgpiddhmanvivaqllfleadnpekdiyiyinspggv
vtagmaiydtmqyikpdvsticvgqaasmgalllasgaagkryalpnsrvmihqplggfq
gqatdidihareiltlrsrlneilakhtgqsletiardterdnfksavdaqayglvdqvl
e

Sequence, based on observed residues (ATOM records):

>d7dfue_ c.14.1.0 (E:) automated matches {Xanthomonas oryzae [TaxId: 347]}
tsrgerydiysrllkerliflvgpiddhmanvivaqllfleadnpekdiyiyinspggvv
tagmaiydtmqyikpdvsticvgqaasmgalllasgaagkryalpnsrvmihqplggfqg
qatdidihareiltlrsrlneilakhtgqsletiardterdnfksavdaqayglvdqvle

Timeline for d7dfue_:

• d7dfue_ first appeared in SCOPe 2.07