Lineage for d1bfia_ (1bfi A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965548Protein Phosphatidylinositol 3-kinase, p85-alpha subunit [55569] (3 species)
  7. 2965549Species Cow (Bos taurus) [TaxId:9913] [55570] (7 PDB entries)
  8. 2965552Domain d1bfia_: 1bfi A: [40499]
    C-terminal SH2 domain

Details for d1bfia_

PDB Entry: 1bfi (more details)

PDB Description: solution structure of the c-terminal sh2 domain of the p85alpha regulatory subunit of phosphoinositide 3-kinase, nmr, 30 structures
PDB Compounds: (A:) p85 alpha

SCOPe Domain Sequences for d1bfia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfia_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]}
edlphhdektwnvgssnrnkaenllrgkrdgtflvresskqgcyacsvvvdgevkhcvin
ktatgygfaepynlysslkelvlhyqhtslvqhndslnvtlaypvyaqqrr

SCOPe Domain Coordinates for d1bfia_:

Click to download the PDB-style file with coordinates for d1bfia_.
(The format of our PDB-style files is described here.)

Timeline for d1bfia_: