Lineage for d1tcea1 (1tce A:1-104)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2571840Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2571841Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2571842Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2572194Protein Shc adaptor protein [55567] (1 species)
  7. 2572195Species Human (Homo sapiens) [TaxId:9606] [55568] (2 PDB entries)
  8. 2572197Domain d1tcea1: 1tce A:1-104 [40497]
    Other proteins in same PDB: d1tcea2

Details for d1tcea1

PDB Entry: 1tce (more details)

PDB Description: solution nmr structure of the shc sh2 domain complexed with a tyrosine-phosphorylated peptide from the t-cell receptor, minimized average structure
PDB Compounds: (A:) shc

SCOPe Domain Sequences for d1tcea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tcea1 d.93.1.1 (A:1-104) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]}
aeqlrgepwfhgklsrreaeallqlngdflvrestttpgqyvltgsqsgqpkhlllvdpe
gvvrtkdhrfesvshlisyhmdnhlpiisagselclqqpverkl

SCOPe Domain Coordinates for d1tcea1:

Click to download the PDB-style file with coordinates for d1tcea1.
(The format of our PDB-style files is described here.)

Timeline for d1tcea1: