Lineage for d1tcea_ (1tce A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.93: SH2-like [55549] (1 superfamily) Superfamily d.93.1: SH2 domain [55550] (1 family) 
Family d.93.1.1: SH2 domain [55551] (20 proteins) 
Protein Shc adaptor protein [55567] (1 species) Species Human (Homo sapiens) [TaxId:9606] [55568] (2 PDB entries) 
Domain d1tcea_: 1tce A: [40497]
Details for d1tcea_
PDB Entry: 1tce (more details)
PDB Description: solution nmr structure of the shc sh2 domain complexed with a tyrosine-phosphorylated peptide from the t-cell receptor, minimized average structure
SCOP Domain Sequences for d1tcea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tcea_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens)}
aeqlrgepwfhgklsrreaeallqlngdflvrestttpgqyvltgsqsgqpkhlllvdpe
gvvrtkdhrfesvshlisyhmdnhlpiisagselclqqpverklleh
SCOP Domain Coordinates for d1tcea_:
Click to download the PDB-style file with coordinates for d1tcea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tcea_:
- d1tcea_ first appeared (with stable ids) in SCOP 1.55
- d1tcea_ appears in SCOP 1.59
- d1tcea_ appears in SCOP 1.63
- d1tcea_ appears in the current release, SCOPe 2.08, called d1tcea1
View in 3D