Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) |
Superfamily d.93.1: SH2 domain [55550] (1 family) |
Family d.93.1.1: SH2 domain [55551] (19 proteins) |
Protein Shc adaptor protein [55567] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55568] (2 PDB entries) |
Domain d1tcea_: 1tce A: [40497] |
PDB Entry: 1tce (more details)
SCOP Domain Sequences for d1tcea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tcea_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens)} aeqlrgepwfhgklsrreaeallqlngdflvrestttpgqyvltgsqsgqpkhlllvdpe gvvrtkdhrfesvshlisyhmdnhlpiisagselclqqpverklleh
Timeline for d1tcea_: