Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Shc adaptor protein [55567] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55568] (2 PDB entries) |
Domain d1tcea1: 1tce A:1-104 [40497] Other proteins in same PDB: d1tcea2 |
PDB Entry: 1tce (more details)
SCOPe Domain Sequences for d1tcea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tcea1 d.93.1.1 (A:1-104) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} aeqlrgepwfhgklsrreaeallqlngdflvrestttpgqyvltgsqsgqpkhlllvdpe gvvrtkdhrfesvshlisyhmdnhlpiisagselclqqpverkl
Timeline for d1tcea1: