SCOPe 2.08: Domain d1tcea1: 1tce A:1-104

Lineage for d1tcea1 (1tce A:1-104)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Shc adaptor protein [55567] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55568] (2 PDB entries)

8. Domain d1tcea1: 1tce A:1-104 [40497]
   Other proteins in same PDB: d1tcea2

Details for d1tcea1

PDB Entry: 1tce

PDB Description: solution nmr structure of the shc sh2 domain complexed with a tyrosine-phosphorylated peptide from the t-cell receptor, minimized average structure

PDB Compounds: (A:) shc

SCOPe Domain Sequences for d1tcea1:

Sequence; same for both SEQRES and ATOM records:

>d1tcea1 d.93.1.1 (A:1-104) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]}
aeqlrgepwfhgklsrreaeallqlngdflvrestttpgqyvltgsqsgqpkhlllvdpe
gvvrtkdhrfesvshlisyhmdnhlpiisagselclqqpverkl

Timeline for d1tcea1:

• d1tcea1 first appeared (with stable ids) in SCOP 1.55, called d1tcea_
  
• d1tcea1 appears in SCOPe 2.07