Lineage for d3hcka1 (3hck A:2-107)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965473Protein Hemopoetic cell kinase Hck [55565] (1 species)
  7. 2965474Species Human (Homo sapiens) [TaxId:9606] [55566] (23 PDB entries)
  8. 2965512Domain d3hcka1: 3hck A:2-107 [40495]
    Other proteins in same PDB: d3hcka2

Details for d3hcka1

PDB Entry: 3hck (more details)

PDB Description: nmr ensemble of the uncomplexed human hck sh2 domain, 20 structures
PDB Compounds: (A:) hck sh2

SCOPe Domain Sequences for d3hcka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hcka1 d.93.1.1 (A:2-107) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eteewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhyk
irtldnggfyisprstfstlqelvdhykkgndglcqklsvpcmssk

SCOPe Domain Coordinates for d3hcka1:

Click to download the PDB-style file with coordinates for d3hcka1.
(The format of our PDB-style files is described here.)

Timeline for d3hcka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hcka2