SCOPe 2.07: Domain d7djzb1: 7djz B:1-105

Lineage for d7djzb1 (7djz B:1-105)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)

8. Domain d7djzb1: 7djz B:1-105 [404947]
   Other proteins in same PDB: d7djzb2, d7djzc_
   automated match to d1dn0a1
   complexed with cit, nag

Details for d7djzb1

PDB Entry: 7djz, 2.4 Å

PDB Description: crystal structure of sars-cov-2 spike rbd in complex with mw01 fab

PDB Compounds: (B:) MW01 light chain

SCOPe Domain Sequences for d7djzb1:

Sequence; same for both SEQRES and ATOM records:

>d7djzb1 b.1.1.1 (B:1-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivmtqspatlsvspgeratlscrasqsvssnlawyqqkpgqaprlliygastratgipa
rfsgsgsgteftltisslqsedfavyycqqysnwltfgggtkvei

Timeline for d7djzb1:

• d7djzb1 is new in SCOPe 2.07-stable
  
• d7djzb1 appears in the current release, SCOPe 2.08