Lineage for d2hcka2 (2hck A:146-248)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135973Fold d.93: SH2-like [55549] (1 superfamily)
  4. 135974Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 135975Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 136045Protein Hemopoetic cell kinase Hck [55565] (1 species)
  7. 136046Species Human (Homo sapiens) [TaxId:9606] [55566] (4 PDB entries)
  8. 136050Domain d2hcka2: 2hck A:146-248 [40493]
    Other proteins in same PDB: d2hcka1, d2hcka3, d2hckb1, d2hckb3

Details for d2hcka2

PDB Entry: 2hck (more details), 3 Å

PDB Description: src family kinase hck-quercetin complex

SCOP Domain Sequences for d2hcka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hcka2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens)}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss

SCOP Domain Coordinates for d2hcka2:

Click to download the PDB-style file with coordinates for d2hcka2.
(The format of our PDB-style files is described here.)

Timeline for d2hcka2: