SCOPe 2.08: Domain d2hcka2: 2hck A:146-248

Lineage for d2hcka2 (2hck A:146-248)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Hemopoetic cell kinase Hck [55565] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55566] (23 PDB entries)

8. Domain d2hcka2: 2hck A:146-248 [40493]
   Other proteins in same PDB: d2hcka1, d2hcka3, d2hckb1, d2hckb3
   complexed with ca, que

Details for d2hcka2

PDB Entry: 2hck, 3 Å

PDB Description: src family kinase hck-quercetin complex

PDB Compounds: (A:) hematopoetic cell kinase hck

SCOPe Domain Sequences for d2hcka2:

Sequence; same for both SEQRES and ATOM records:

>d2hcka2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss

Timeline for d2hcka2:

• d2hcka2 first appeared (with stable ids) in SCOP 1.55
  
• d2hcka2 appears in SCOPe 2.07