Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.9: Peptidylarginine deiminase Pad4, middle domain [110083] (2 families) automatically mapped to Pfam PF08527 |
Family b.2.9.0: automated matches [272207] (1 protein) not a true family |
Protein automated matches [272208] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [272209] (26 PDB entries) |
Domain d7d5va2: 7d5v A:115-293 [404919] Other proteins in same PDB: d7d5va1, d7d5va3, d7d5vb1, d7d5vb3 automated match to d2dexx1 complexed with edo, gol; mutant |
PDB Entry: 7d5v (more details), 2.1 Å
SCOPe Domain Sequences for d7d5va2:
Sequence, based on SEQRES records: (download)
>d7d5va2 b.2.9.0 (A:115-293) automated matches {Human (Homo sapiens) [TaxId: 9606]} vdisldcdlncegrqdrnfvdkrqwvwgpsgyggillvncdrddpscdvqdncdqhvhcl qdledmsvmvlrtqgpaalfddhklvlhtssydakraqvfhicgpedvceayrhvlgqdk vsyevprlhgdeerffveglsfpdagftglisfhvtllddsnedfsaspiftdtvvfrv
>d7d5va2 b.2.9.0 (A:115-293) automated matches {Human (Homo sapiens) [TaxId: 9606]} vdisldcdlncegrqdrnfvdkrqwvwgpsgyggillvncdrdlqdledmsvmvlrtqgp aalfddhklvlhtssydakraqvfhicgpedvceayrhvlgqdkvsyevprlhgdeerff veglsfpdagftglisfhvtllddsnedfsaspiftdtvvfrv
Timeline for d7d5va2: