SCOPe 2.08: Domain d7d5va2: 7d5v A:115-293

Lineage for d7d5va2 (7d5v A:115-293)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.9: Peptidylarginine deiminase Pad4, middle domain [110083] (2 families)
   automatically mapped to Pfam PF08527

5. Family b.2.9.0: automated matches [272207] (1 protein)
   not a true family

6. Protein automated matches [272208] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [272209] (26 PDB entries)

8. Domain d7d5va2: 7d5v A:115-293 [404919]
   Other proteins in same PDB: d7d5va1, d7d5va3, d7d5vb1, d7d5vb3
   automated match to d2dexx1
   complexed with edo, gol; mutant

Details for d7d5va2

PDB Entry: 7d5v, 2.1 Å

PDB Description: structure of the c646a mutant of peptidylarginine deiminase type iii (pad3)

PDB Compounds: (A:) Protein-arginine deiminase type-3

SCOPe Domain Sequences for d7d5va2:

Sequence, based on SEQRES records:

>d7d5va2 b.2.9.0 (A:115-293) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdisldcdlncegrqdrnfvdkrqwvwgpsgyggillvncdrddpscdvqdncdqhvhcl
qdledmsvmvlrtqgpaalfddhklvlhtssydakraqvfhicgpedvceayrhvlgqdk
vsyevprlhgdeerffveglsfpdagftglisfhvtllddsnedfsaspiftdtvvfrv

Sequence, based on observed residues (ATOM records):

>d7d5va2 b.2.9.0 (A:115-293) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdisldcdlncegrqdrnfvdkrqwvwgpsgyggillvncdrdlqdledmsvmvlrtqgp
aalfddhklvlhtssydakraqvfhicgpedvceayrhvlgqdkvsyevprlhgdeerff
veglsfpdagftglisfhvtllddsnedfsaspiftdtvvfrv

Timeline for d7d5va2:

• d7d5va2 first appeared in SCOPe 2.07