Lineage for d1ad5a2 (1ad5 A:146-248)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1035347Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 1035348Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1035349Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1035569Protein Hemopoetic cell kinase Hck [55565] (1 species)
  7. 1035570Species Human (Homo sapiens) [TaxId:9606] [55566] (4 PDB entries)
  8. 1035572Domain d1ad5a2: 1ad5 A:146-248 [40491]
    Other proteins in same PDB: d1ad5a1, d1ad5a3, d1ad5b1, d1ad5b3
    complexed with anp, ca

Details for d1ad5a2

PDB Entry: 1ad5 (more details), 2.6 Å

PDB Description: src family kinase hck-amp-pnp complex
PDB Compounds: (A:) haematopoetic cell kinase hck

SCOPe Domain Sequences for d1ad5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ad5a2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss

SCOPe Domain Coordinates for d1ad5a2:

Click to download the PDB-style file with coordinates for d1ad5a2.
(The format of our PDB-style files is described here.)

Timeline for d1ad5a2: