SCOPe 2.08: Domain d7cwqa_: 7cwq A:

Lineage for d7cwqa_ (7cwq A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Burkholderiales bacterium [TaxId:1797562] [404889] (1 PDB entry)

8. Domain d7cwqa_: 7cwq A: [404890]
   automated match to d5luja_
   complexed with so4

Details for d7cwqa_

PDB Entry: 7cwq, 1.65 Å

PDB Description: crystal structure of a novel cutinase from burkhoderiales bacterium rifcsplowo2_02_full_57_36

PDB Compounds: (A:) DLH domain-containing protein

SCOPe Domain Sequences for d7cwqa_:

Sequence; same for both SEQRES and ATOM records:

>d7cwqa_ c.69.1.0 (A:) automated matches {Burkholderiales bacterium [TaxId: 1797562]}
mnpfekgpdptktmleastgpftyttttvssttasgyrqgtiyhptnvtgpfaavavvpg
ylasqssinwwgprlashgfvvitidtnstsdqppsratqlmaalnqlktfsntsshpiy
rkvdpnrlgvmgwsmggggtliaardnptlkaaipfapwnsstnfstvsvptliiacesd
stapvnshaspfynslpsttkkaylemnngshscansgnsnagligkygvswmkrfmdnd
trfspylcgaphqadlsltaideyrencpy

Timeline for d7cwqa_:

• d7cwqa_ first appeared in SCOPe 2.07