Lineage for d1qg1e1 (1qg1 E:3-104)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206459Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2206460Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2206461Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2206615Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)
  7. 2206616Species Human (Homo sapiens) [TaxId:9606] [55564] (35 PDB entries)
  8. 2206683Domain d1qg1e1: 1qg1 E:3-104 [40489]
    Other proteins in same PDB: d1qg1e2

Details for d1qg1e1

PDB Entry: 1qg1 (more details)

PDB Description: growth factor receptor binding protein sh2 domain complexed with an shc-derived peptide
PDB Compounds: (E:) protein (growth factor receptor binding protein)

SCOPe Domain Sequences for d1qg1e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qg1e1 d.93.1.1 (E:3-104) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}
hpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgagk
yflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqpt

SCOPe Domain Coordinates for d1qg1e1:

Click to download the PDB-style file with coordinates for d1qg1e1.
(The format of our PDB-style files is described here.)

Timeline for d1qg1e1: