Lineage for d7ciyb_ (7ciy B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2617619Fold d.386: Tyrosinase cofactor MelC1-like [254118] (1 superfamily)
    2 layers: a/b; antiparallel beta-sheet of 6 strands partly surrounding one helix. Fold-level similarity and potential homology to SH2 domains (d.93) noted in PubMed 16436386
  4. 2617620Superfamily d.386.1: Tyrosinase cofactor MelC1 [254141] (2 families) (S)
    Pfam PF06236
  5. 2617621Family d.386.1.1: Tyrosinase cofactor MelC1 [254186] (2 proteins)
  6. 2617658Protein automated matches [404752] (1 species)
    not a true protein
  7. 2617659Species Streptomyces castaneoglobisporus [TaxId:79261] [404753] (2 PDB entries)
  8. 2617660Domain d7ciyb_: 7ciy B: [404887]
    Other proteins in same PDB: d7ciya1, d7ciya2
    automated match to d2zmzb_
    complexed with cu, no3, peo

Details for d7ciyb_

PDB Entry: 7ciy (more details), 1.47 Å

PDB Description: crystal structure of n191g-mutated tyrosinase from streptomyces castaneoglobisporus in complex with the caddie protein obtained by soaking in the solution containing cu(ii) and hydroxylamine for 24 h
PDB Compounds: (B:) MelC

SCOPe Domain Sequences for d7ciyb_:

Sequence, based on SEQRES records: (download)

>d7ciyb_ d.386.1.1 (B:) automated matches {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpargaahhhehgggyevfvdgvqlhvmrnadgswisvvshxd
pvptpraaaraavdelqgapllpf

Sequence, based on observed residues (ATOM records): (download)

>d7ciyb_ d.386.1.1 (B:) automated matches {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpahehgggyevfvdgvqlhvmrnadgswisvvshxdpvptpr
aaaraavdelqgapllpf

SCOPe Domain Coordinates for d7ciyb_:

Click to download the PDB-style file with coordinates for d7ciyb_.
(The format of our PDB-style files is described here.)

Timeline for d7ciyb_: