Lineage for d1fhs__ (1fhs -)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 608035Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 608036Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 608037Family d.93.1.1: SH2 domain [55551] (31 proteins)
    Pfam 00017
  6. 608169Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)
  7. 608170Species Human (Homo sapiens) [TaxId:9606] [55564] (13 PDB entries)
  8. 608198Domain d1fhs__: 1fhs - [40488]

Details for d1fhs__

PDB Entry: 1fhs (more details)

PDB Description: the three-dimensional solution structure of the src homology domain-2 of the growth factor receptor bound protein-2, nmr, 18 structures

SCOP Domain Sequences for d1fhs__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhs__ d.93.1.1 (-) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens)}
giemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvl
rdgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyvqa

SCOP Domain Coordinates for d1fhs__:

Click to download the PDB-style file with coordinates for d1fhs__.
(The format of our PDB-style files is described here.)

Timeline for d1fhs__: