Lineage for d1fhsa1 (1fhs A:2-112)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965387Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)
  7. 2965388Species Human (Homo sapiens) [TaxId:9606] [55564] (38 PDB entries)
  8. 2965457Domain d1fhsa1: 1fhs A:2-112 [40488]
    Other proteins in same PDB: d1fhsa2

Details for d1fhsa1

PDB Entry: 1fhs (more details)

PDB Description: the three-dimensional solution structure of the src homology domain-2 of the growth factor receptor bound protein-2, nmr, 18 structures
PDB Compounds: (A:) growth factor receptor bound protein-2

SCOPe Domain Sequences for d1fhsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhsa1 d.93.1.1 (A:2-112) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}
iemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlr
dgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyvqa

SCOPe Domain Coordinates for d1fhsa1:

Click to download the PDB-style file with coordinates for d1fhsa1.
(The format of our PDB-style files is described here.)

Timeline for d1fhsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fhsa2