Lineage for d7cyfe_ (7cyf E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557428Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2557730Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2557731Protein automated matches [190753] (21 species)
    not a true protein
  7. 2557906Species Synechocystis sp. [TaxId:1111708] [352162] (4 PDB entries)
  8. 2557915Domain d7cyfe_: 7cyf E: [404854]
    automated match to d3dfeb_
    complexed with amp, na

Details for d7cyfe_

PDB Entry: 7cyf (more details), 3.15 Å

PDB Description: cryo-em structure of bicarbonate transporter sbta in complex with pii- like signaling protein sbtb from synechocystis sp. pcc 6803
PDB Compounds: (E:) Membrane-associated protein slr1513

SCOPe Domain Sequences for d7cyfe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cyfe_ d.58.5.0 (E:) automated matches {Synechocystis sp. [TaxId: 1111708]}
akpanklvivtekillkkiakiidesgakgytvmntggkgsrnvrssgqpntsdieanik
feiltetremaeeiadrvavkyfndyagiiyicsaevlyghtfcgpegc

SCOPe Domain Coordinates for d7cyfe_:

Click to download the PDB-style file with coordinates for d7cyfe_.
(The format of our PDB-style files is described here.)

Timeline for d7cyfe_: