| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
| Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
| Protein automated matches [190753] (21 species) not a true protein |
| Species Synechocystis sp. [TaxId:1111708] [352162] (4 PDB entries) |
| Domain d7cyfe_: 7cyf E: [404854] automated match to d3dfeb_ complexed with amp, na |
PDB Entry: 7cyf (more details), 3.15 Å
SCOPe Domain Sequences for d7cyfe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cyfe_ d.58.5.0 (E:) automated matches {Synechocystis sp. [TaxId: 1111708]}
akpanklvivtekillkkiakiidesgakgytvmntggkgsrnvrssgqpntsdieanik
feiltetremaeeiadrvavkyfndyagiiyicsaevlyghtfcgpegc
Timeline for d7cyfe_: