Class a: All alpha proteins [46456] (289 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) consists of single alpha-helix and irregular N-terminal tail automatically mapped to Pfam PF02315 |
Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins) |
Protein automated matches [190583] (3 species) not a true protein |
Species Methylococcus capsulatus [TaxId:243233] [260039] (5 PDB entries) |
Domain d7ce9p_: 7ce9 P: [404807] Other proteins in same PDB: d7ce9a_, d7ce9b_, d7ce9c_, d7ce9d_, d7ce9g_, d7ce9h_, d7ce9m_, d7ce9n_ automated match to d4tqom_ complexed with ca, pqq |
PDB Entry: 7ce9 (more details), 2.2 Å
SCOPe Domain Sequences for d7ce9p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ce9p_ a.137.2.1 (P:) automated matches {Methylococcus capsulatus [TaxId: 243233]} ydgthckapgncwepkpgypdkvagskydpkhdpnelnkqaesikamearnqkrvenyak tgkfvykvedi
Timeline for d7ce9p_: