Lineage for d7ce9p_ (7ce9 P:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2346684Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2346747Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) (S)
    consists of single alpha-helix and irregular N-terminal tail
    automatically mapped to Pfam PF02315
  5. 2346748Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)
  6. 2346775Protein automated matches [190583] (3 species)
    not a true protein
  7. 2346780Species Methylococcus capsulatus [TaxId:243233] [260039] (5 PDB entries)
  8. 2346804Domain d7ce9p_: 7ce9 P: [404807]
    Other proteins in same PDB: d7ce9a_, d7ce9b_, d7ce9c_, d7ce9d_, d7ce9g_, d7ce9h_, d7ce9m_, d7ce9n_
    automated match to d4tqom_
    complexed with ca, pqq

Details for d7ce9p_

PDB Entry: 7ce9 (more details), 2.2 Å

PDB Description: pqq-soaked apo-methanol dehydrogenase (mdh) from methylococcus capsulatus (bath)
PDB Compounds: (P:) Methanol dehydrogenase [cytochrome c] subunit 2

SCOPe Domain Sequences for d7ce9p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ce9p_ a.137.2.1 (P:) automated matches {Methylococcus capsulatus [TaxId: 243233]}
ydgthckapgncwepkpgypdkvagskydpkhdpnelnkqaesikamearnqkrvenyak
tgkfvykvedi

SCOPe Domain Coordinates for d7ce9p_:

Click to download the PDB-style file with coordinates for d7ce9p_.
(The format of our PDB-style files is described here.)

Timeline for d7ce9p_: