SCOPe 2.07: Domain d7ciya1: 7ciy A:2-272

Lineage for d7ciya1 (7ciy A:2-272)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
   multihelical

4. Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families)
   duplication: contains two structural repeats

5. Family a.86.1.0: automated matches [254307] (1 protein)
   not a true family

6. Protein automated matches [254708] (4 species)
   not a true protein

7. Species Streptomyces castaneoglobisporus [TaxId:79261] [361811] (12 PDB entries)

8. Domain d7ciya1: 7ciy A:2-272 [404791]
   Other proteins in same PDB: d7ciya2, d7ciyb_
   automated match to d4hd7a_
   complexed with cu, no3, peo

Details for d7ciya1

PDB Entry: 7ciy, 1.47 Å

PDB Description: crystal structure of n191g-mutated tyrosinase from streptomyces castaneoglobisporus in complex with the caddie protein obtained by soaking in the solution containing cu(ii) and hydroxylamine for 24 h

PDB Compounds: (A:) tyrosinase

SCOPe Domain Sequences for d7ciya1:

Sequence; same for both SEQRES and ATOM records:

>d7ciya1 a.86.1.0 (A:2-272) automated matches {Streptomyces castaneoglobisporus [TaxId: 79261]}
tvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsflp
whrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpfa
astgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnhl
egwrgvnlhgrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptggt
pdvvdlnetmkpwntvrpadlldhtayytfd

Timeline for d7ciya1:

• d7ciya1 is new in SCOPe 2.07-stable
  
• d7ciya1 appears in the current release, SCOPe 2.08