Lineage for d7ciya1 (7ciy A:2-272)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332526Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 2332527Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 2332594Family a.86.1.0: automated matches [254307] (1 protein)
    not a true family
  6. 2332595Protein automated matches [254708] (4 species)
    not a true protein
  7. 2332656Species Streptomyces castaneoglobisporus [TaxId:79261] [361811] (12 PDB entries)
  8. 2332663Domain d7ciya1: 7ciy A:2-272 [404791]
    Other proteins in same PDB: d7ciya2, d7ciyb_
    automated match to d4hd7a_
    complexed with cu, no3, peo

Details for d7ciya1

PDB Entry: 7ciy (more details), 1.47 Å

PDB Description: crystal structure of n191g-mutated tyrosinase from streptomyces castaneoglobisporus in complex with the caddie protein obtained by soaking in the solution containing cu(ii) and hydroxylamine for 24 h
PDB Compounds: (A:) tyrosinase

SCOPe Domain Sequences for d7ciya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ciya1 a.86.1.0 (A:2-272) automated matches {Streptomyces castaneoglobisporus [TaxId: 79261]}
tvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsflp
whrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpfa
astgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnhl
egwrgvnlhgrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptggt
pdvvdlnetmkpwntvrpadlldhtayytfd

SCOPe Domain Coordinates for d7ciya1:

Click to download the PDB-style file with coordinates for d7ciya1.
(The format of our PDB-style files is described here.)

Timeline for d7ciya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7ciya2
View in 3D
Domains from other chains:
(mouse over for more information)
d7ciyb_