Lineage for d1cj1a_ (1cj1 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 608035Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 608036Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 608037Family d.93.1.1: SH2 domain [55551] (31 proteins)
    Pfam 00017
  6. 608169Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)
  7. 608170Species Human (Homo sapiens) [TaxId:9606] [55564] (13 PDB entries)
  8. 608185Domain d1cj1a_: 1cj1 A: [40476]

Details for d1cj1a_

PDB Entry: 1cj1 (more details), 3 Å

PDB Description: growth factor receptor binding protein sh2 domain (human) complexed with a phosphotyrosyl derivative

SCOP Domain Sequences for d1cj1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cj1a_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens)}
phpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgag
kyflwvvkfnslnelvdyhrstsvsrnqqiflrdie

SCOP Domain Coordinates for d1cj1a_:

Click to download the PDB-style file with coordinates for d1cj1a_.
(The format of our PDB-style files is described here.)

Timeline for d1cj1a_: