SCOPe 2.07: Domain d7citb_: 7cit B:

Lineage for d7citb_ (7cit B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.386: Tyrosinase cofactor MelC1-like [254118] (1 superfamily)
   2 layers: a/b; antiparallel beta-sheet of 6 strands partly surrounding one helix. Fold-level similarity and potential homology to SH2 domains (d.93) noted in PubMed 16436386

4. Superfamily d.386.1: Tyrosinase cofactor MelC1 [254141] (2 families)
   Pfam PF06236

5. Family d.386.1.1: Tyrosinase cofactor MelC1 [254186] (2 proteins)

6. Protein automated matches [404752] (1 species)
   not a true protein

7. Species Streptomyces castaneoglobisporus [TaxId:79261] [404753] (2 PDB entries)

8. Domain d7citb_: 7cit B: [404754]
   Other proteins in same PDB: d7cita1, d7cita2
   automated match to d2zmzb_
   complexed with cu, g1x, no3, peo

Details for d7citb_

PDB Entry: 7cit, 1.5 Å

PDB Description: crystal structure of tyrosinase from streptomyces castaneoglobisporus in complex with the caddie protein obtained by soaking in the solution containing cu(ii) and hydroxylamine for 24 h

PDB Compounds: (B:) MelC

SCOPe Domain Sequences for d7citb_:

Sequence, based on SEQRES records:

>d7citb_ d.386.1.1 (B:) automated matches {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpargaahhhehgggyevfvdgvqlhvmrnadgswisvvshxd
pvptpraaaraavdelqgapllpf

Sequence, based on observed residues (ATOM records):

>d7citb_ d.386.1.1 (B:) automated matches {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpahehgggyevfvdgvqlhvmrnadgswisvvshxdpvptpr
aaaraavdelqgapllpf

Timeline for d7citb_:

• d7citb_ is new in SCOPe 2.07-stable
  
• d7citb_ appears in the current release, SCOPe 2.08