![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.386: Tyrosinase cofactor MelC1-like [254118] (1 superfamily) 2 layers: a/b; antiparallel beta-sheet of 6 strands partly surrounding one helix. Fold-level similarity and potential homology to SH2 domains (d.93) noted in PubMed 16436386 |
![]() | Superfamily d.386.1: Tyrosinase cofactor MelC1 [254141] (2 families) ![]() Pfam PF06236 |
![]() | Family d.386.1.1: Tyrosinase cofactor MelC1 [254186] (2 proteins) |
![]() | Protein automated matches [404752] (1 species) not a true protein |
![]() | Species Streptomyces castaneoglobisporus [TaxId:79261] [404753] (2 PDB entries) |
![]() | Domain d7citb_: 7cit B: [404754] Other proteins in same PDB: d7cita1, d7cita2 automated match to d2zmzb_ complexed with cu, g1x, no3, peo |
PDB Entry: 7cit (more details), 1.5 Å
SCOPe Domain Sequences for d7citb_:
Sequence, based on SEQRES records: (download)
>d7citb_ d.386.1.1 (B:) automated matches {Streptomyces castaneoglobisporus [TaxId: 79261]} aapesfdevykgrriqgrpargaahhhehgggyevfvdgvqlhvmrnadgswisvvshxd pvptpraaaraavdelqgapllpf
>d7citb_ d.386.1.1 (B:) automated matches {Streptomyces castaneoglobisporus [TaxId: 79261]} aapesfdevykgrriqgrpahehgggyevfvdgvqlhvmrnadgswisvvshxdpvptpr aaaraavdelqgapllpf
Timeline for d7citb_: