Lineage for d1grib3 (1gri B:57-156)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1424633Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 1424634Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1424635Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1424785Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)
  7. 1424786Species Human (Homo sapiens) [TaxId:9606] [55564] (34 PDB entries)
  8. 1424834Domain d1grib3: 1gri B:57-156 [40474]
    Other proteins in same PDB: d1gria1, d1gria2, d1grib1, d1grib2

Details for d1grib3

PDB Entry: 1gri (more details), 3.1 Å

PDB Description: grb2
PDB Compounds: (B:) growth factor bound protein 2

SCOPe Domain Sequences for d1grib3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1grib3 d.93.1.1 (B:57-156) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}
phpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgag
kyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpq

SCOPe Domain Coordinates for d1grib3:

Click to download the PDB-style file with coordinates for d1grib3.
(The format of our PDB-style files is described here.)

Timeline for d1grib3: