Lineage for d1gria3 (1gri A:57-156)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729699Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 729700Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 729701Family d.93.1.1: SH2 domain [55551] (32 proteins)
    Pfam PF00017
  6. 729836Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)
  7. 729837Species Human (Homo sapiens) [TaxId:9606] [55564] (20 PDB entries)
  8. 729859Domain d1gria3: 1gri A:57-156 [40473]
    Other proteins in same PDB: d1gria1, d1gria2, d1grib1, d1grib2

Details for d1gria3

PDB Entry: 1gri (more details), 3.1 Å

PDB Description: grb2
PDB Compounds: (A:) growth factor bound protein 2

SCOP Domain Sequences for d1gria3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gria3 d.93.1.1 (A:57-156) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}
phpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgag
kyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpq

SCOP Domain Coordinates for d1gria3:

Click to download the PDB-style file with coordinates for d1gria3.
(The format of our PDB-style files is described here.)

Timeline for d1gria3: