| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
| Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
| Protein automated matches [226837] (9 species) not a true protein |
| Species Pig (Sus scrofa) [TaxId:9823] [278808] (66 PDB entries) |
| Domain d7cdac1: 7cda C:1-245 [404724] Other proteins in same PDB: d7cdaa2, d7cdab2, d7cdac2, d7cdad2, d7cdae_, d7cdaf1, d7cdaf2, d7cdaf3 automated match to d5fnva1 complexed with acp, aeu, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 7cda (more details), 2.66 Å
SCOPe Domain Sequences for d7cdac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cdac1 c.32.1.1 (C:1-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd
Timeline for d7cdac1: