SCOPe 2.07: Domain d7ce8b1: 7ce8 B:2-243

Lineage for d7ce8b1 (7ce8 B:2-243)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (10 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278808] (54 PDB entries)

8. Domain d7ce8b1: 7ce8 B:2-243 [404721]
   Other proteins in same PDB: d7ce8a2, d7ce8b2, d7ce8c2, d7ce8d2, d7ce8e_, d7ce8f1, d7ce8f2, d7ce8f3
   automated match to d4drxb1
   complexed with acp, aex, ca, gdp, gol, gtp, mes, mg

Details for d7ce8b1

PDB Entry: 7ce8, 2.73 Å

PDB Description: crystal structure of t2r-ttl-compound11 complex

PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d7ce8b1:

Sequence; same for both SEQRES and ATOM records:

>d7ce8b1 c.32.1.1 (B:2-243) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Timeline for d7ce8b1:

• d7ce8b1 is new in SCOPe 2.07-stable
  
• d7ce8b1 appears in the current release, SCOPe 2.08