Lineage for d7ce8c2 (7ce8 C:246-440)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959213Protein automated matches [227071] (7 species)
    not a true protein
  7. 2959756Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries)
  8. 2959810Domain d7ce8c2: 7ce8 C:246-440 [404718]
    Other proteins in same PDB: d7ce8a1, d7ce8b1, d7ce8c1, d7ce8d1, d7ce8e_, d7ce8f1, d7ce8f2, d7ce8f3
    automated match to d4i50a2
    complexed with acp, aex, ca, gdp, gol, gtp, mes, mg

Details for d7ce8c2

PDB Entry: 7ce8 (more details), 2.73 Å

PDB Description: crystal structure of t2r-ttl-compound11 complex
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d7ce8c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ce8c2 d.79.2.1 (C:246-440) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d7ce8c2:

Click to download the PDB-style file with coordinates for d7ce8c2.
(The format of our PDB-style files is described here.)

Timeline for d7ce8c2: