SCOPe 2.08: Domain d7cdab2: 7cda B:244-428

Lineage for d7cdab2 (7cda B:244-428)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (7 species)
not a true protein
Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries)

Domain d7cdab2: 7cda B:244-428 [404711]
Other proteins in same PDB: d7cdaa1, d7cdab1, d7cdac1, d7cdad1, d7cdae_, d7cdaf1, d7cdaf2, d7cdaf3
automated match to d3rycd2
complexed with acp, aeu, ca, gdp, gol, gtp, mes, mg

Details for d7cdab2

PDB Entry: 7cda (more details), 2.66 Å

PDB Description: crystal structure of t2r-ttl-pac complex

PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d7cdab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cdab2 d.79.2.1 (B:244-428) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

SCOPe Domain Coordinates for d7cdab2:

Click to download the PDB-style file with coordinates for d7cdab2.
(The format of our PDB-style files is described here.)

Timeline for d7cdab2: