| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
| Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
| Protein automated matches [227071] (7 species) not a true protein |
| Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries) |
| Domain d7cdab2: 7cda B:244-428 [404711] Other proteins in same PDB: d7cdaa1, d7cdab1, d7cdac1, d7cdad1, d7cdae_, d7cdaf1, d7cdaf2, d7cdaf3 automated match to d3rycd2 complexed with acp, aeu, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 7cda (more details), 2.66 Å
SCOPe Domain Sequences for d7cdab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cdab2 d.79.2.1 (B:244-428) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda
Timeline for d7cdab2: