Lineage for d1fyrc_ (1fyr C:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729699Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 729700Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 729701Family d.93.1.1: SH2 domain [55551] (32 proteins)
    Pfam PF00017
  6. 729836Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)
  7. 729837Species Human (Homo sapiens) [TaxId:9606] [55564] (20 PDB entries)
  8. 729855Domain d1fyrc_: 1fyr C: [40471]

Details for d1fyrc_

PDB Entry: 1fyr (more details), 2.4 Å

PDB Description: dimer formation through domain swapping in the crystal structure of the grb2-sh2 ac-pyvnv complex
PDB Compounds: (C:) Growth factor receptor-bound protein 2

SCOP Domain Sequences for d1fyrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyrc_ d.93.1.1 (C:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}
mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdie

SCOP Domain Coordinates for d1fyrc_:

Click to download the PDB-style file with coordinates for d1fyrc_.
(The format of our PDB-style files is described here.)

Timeline for d1fyrc_: