SCOPe 2.05: Domain d1fyrb_: 1fyr B:

Lineage for d1fyrb_ (1fyr B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55564] (34 PDB entries)

8. Domain d1fyrb_: 1fyr B: [40470]

Details for d1fyrb_

PDB Entry: 1fyr, 2.4 Å

PDB Description: dimer formation through domain swapping in the crystal structure of the grb2-sh2 ac-pyvnv complex

PDB Compounds: (B:) Growth factor receptor-bound protein 2

SCOPe Domain Sequences for d1fyrb_:

Sequence; same for both SEQRES and ATOM records:

>d1fyrb_ d.93.1.1 (B:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}
mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdie

Timeline for d1fyrb_:

• d1fyrb_ first appeared (with stable ids) in SCOP 1.55
  
• d1fyrb_ appears in SCOPe 2.04
  
• d1fyrb_ appears in SCOPe 2.06
  
• d1fyrb_ appears in the current release, SCOPe 2.08