Lineage for d1fyrb_ (1fyr B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34525Fold d.93: SH2-like [55549] (1 superfamily)
  4. 34526Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 34527Family d.93.1.1: SH2 domain [55551] (19 proteins)
  6. 34563Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)
  7. 34564Species Human (Homo sapiens) [TaxId:9606] [55564] (10 PDB entries)
  8. 34570Domain d1fyrb_: 1fyr B: [40470]

Details for d1fyrb_

PDB Entry: 1fyr (more details), 2.4 Å

PDB Description: dimer formation through domain swapping in the crystal structure of the grb2-sh2 ac-pyvnv complex

SCOP Domain Sequences for d1fyrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyrb_ d.93.1.1 (B:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens)}
mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdie

SCOP Domain Coordinates for d1fyrb_:

Click to download the PDB-style file with coordinates for d1fyrb_.
(The format of our PDB-style files is described here.)

Timeline for d1fyrb_: