Lineage for d7cndb_ (7cnd B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412582Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2412583Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2413229Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2413230Protein automated matches [190052] (8 species)
    not a true protein
  7. 2413231Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (62 PDB entries)
  8. 2413233Domain d7cndb_: 7cnd B: [404695]
    Other proteins in same PDB: d7cnda_
    automated match to d5uwsb_
    complexed with cl, dms, g6u, gol, gtp, mg, mpo

Details for d7cndb_

PDB Entry: 7cnd (more details), 1.8 Å

PDB Description: nci-1 in complex with crm1-ran-ranbp1
PDB Compounds: (B:) YRB1 isoform 1

SCOPe Domain Sequences for d7cndb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cndb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdktlkicanhi
iapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeefekaqeink
k

SCOPe Domain Coordinates for d7cndb_:

Click to download the PDB-style file with coordinates for d7cndb_.
(The format of our PDB-style files is described here.)

Timeline for d7cndb_: