Class b: All beta proteins [48724] (178 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (8 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (62 PDB entries) |
Domain d7cndb_: 7cnd B: [404695] Other proteins in same PDB: d7cnda_ automated match to d5uwsb_ complexed with cl, dms, g6u, gol, gtp, mg, mpo |
PDB Entry: 7cnd (more details), 1.8 Å
SCOPe Domain Sequences for d7cndb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cndb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} eedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdktlkicanhi iapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeefekaqeink k
Timeline for d7cndb_: